Anti-CTBP1

Catalog Number: ATA-HPA018987
Article Name: Anti-CTBP1
Biozol Catalog Number: ATA-HPA018987
Supplier Catalog Number: HPA018987
Alternative Catalog Number: ATA-HPA018987-100,ATA-HPA018987-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BARS
C-terminal binding protein 1
Anti-CTBP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1487
UniProt: Q13363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CTBP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferus ducts.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CTBP1 antibody. Remaining relative intensity is presented.
HPA018987-100ul
HPA018987-100ul
HPA018987-100ul