Anti-CHN2

Catalog Number: ATA-HPA019026
Article Name: Anti-CHN2
Biozol Catalog Number: ATA-HPA019026
Supplier Catalog Number: HPA019026
Alternative Catalog Number: ATA-HPA019026-100,ATA-HPA019026-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARHGAP3, RhoGAP3
Clonality: Polyclonal
Isotype: IgG
NCBI: 1124
UniProt: P52757
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHT
Target: CHN2
Antibody Type: Monoclonal Antibody
HPA019026-100ul