Anti-RBM28

Catalog Number: ATA-HPA019058
Article Name: Anti-RBM28
Biozol Catalog Number: ATA-HPA019058
Supplier Catalog Number: HPA019058
Alternative Catalog Number: ATA-HPA019058-100,ATA-HPA019058-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10377
RNA binding motif protein 28
Anti-RBM28
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55131
UniProt: Q9NW13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLINNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RBM28
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and liver tissues using Anti-RBM28 antibody. Corresponding RBM28 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA019058-100ul
HPA019058-100ul
HPA019058-100ul