Anti-COL6A1

Catalog Number: ATA-HPA019142
Article Name: Anti-COL6A1
Biozol Catalog Number: ATA-HPA019142
Supplier Catalog Number: HPA019142
Alternative Catalog Number: ATA-HPA019142-100,ATA-HPA019142-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: COL6A1
collagen, type VI, alpha 1
Anti-COL6A1
Clonality: Polyclonal
Concentration: 0.6 mg/ml
Isotype: IgG
NCBI: 1291
UniProt: P12109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDAFLKNVTAQICIDKKCPDYTCPITFSSPADITILLD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COL6A1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human gallbladder and pancreas tissues using Anti-COL6A1 antibody. Corresponding COL6A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human gallbladder shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA019142-100ul
HPA019142-100ul
HPA019142-100ul