Anti-NUDCD3

Catalog Number: ATA-HPA019529
Article Name: Anti-NUDCD3
Biozol Catalog Number: ATA-HPA019529
Supplier Catalog Number: HPA019529
Alternative Catalog Number: ATA-HPA019529-100,ATA-HPA019529-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1068
NudC domain containing 3
Anti-NUDCD3
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 23386
UniProt: Q8IVD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NUDCD3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-NUDCD3 antibody. Corresponding NUDCD3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA019529-100ul
HPA019529-100ul
HPA019529-100ul