Anti-PER3
Catalog Number:
ATA-HPA019530
- Images (8)
| Article Name: | Anti-PER3 |
| Biozol Catalog Number: | ATA-HPA019530 |
| Supplier Catalog Number: | HPA019530 |
| Alternative Catalog Number: | ATA-HPA019530-100,ATA-HPA019530-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PER3 |
| period circadian clock 3 |
| Anti-PER3 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 8863 |
| UniProt: | P56645 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QPVHVSVSSGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIESMTKSSFKPVTGTRTEPNGGGESANGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQIN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PER3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows strong positivity in erythrocytes. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. |
|
|
HPA019530-100ul |
|
|
HPA019530-100ul |
|
|
HPA019530-100ul |
Product Guarantee and Expert Support
