Anti-MIER1

Catalog Number: ATA-HPA019589
Article Name: Anti-MIER1
Biozol Catalog Number: ATA-HPA019589
Supplier Catalog Number: HPA019589
Alternative Catalog Number: ATA-HPA019589-100,ATA-HPA019589-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: hMI-ER1, KIAA1610, MI-ER1
mesoderm induction early response 1, transcriptional regulator
Anti-MIER1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 57708
UniProt: Q8N108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MIER1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-MIER1 antibody. Corresponding MIER1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA019589-100ul
HPA019589-100ul
HPA019589-100ul