Anti-FNBP1

Catalog Number: ATA-HPA019635
Article Name: Anti-FNBP1
Biozol Catalog Number: ATA-HPA019635
Supplier Catalog Number: HPA019635
Alternative Catalog Number: ATA-HPA019635-100,ATA-HPA019635-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FBP17, KIAA0554
formin binding protein 1
Anti-FNBP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23048
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FNBP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FNBP1 antibody. Corresponding FNBP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, lymph node, skeletal muscle and testis using Anti-FNBP1 antibody HPA019635 (A) shows similar protein distribution across tissues to independent antibody HPA019691 (B).
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human testis using Anti-FNBP1 antibody HPA019635.
Immunohistochemical staining of human colon using Anti-FNBP1 antibody HPA019635.
HPA019635-100ul
HPA019635-100ul
HPA019635-100ul