Anti-FNBP1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FNBP1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA019635
• Supplier Catalog Number: HPA019635
• Alternative Catalog Number: ATA-HPA019635-100,ATA-HPA019635-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FBP17, KIAA0554

Product Description

formin binding protein 1

Additional Information

Anti-FNBP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 23048
• UniProt: None
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FNBP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-FNBP1 antibody. Corresponding FNBP1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, lymph node, skeletal muscle and testis using Anti-FNBP1 antibody HPA019635 (A) shows similar protein distribution across tissues to independent antibody HPA019691 (B).

Immunohistochemical staining of human lymph node shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human testis using Anti-FNBP1 antibody HPA019635.

Immunohistochemical staining of human colon using Anti-FNBP1 antibody HPA019635.

HPA019635

HPA019635

HPA019635