Anti-RABEP1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA019669
- Images (9)
| Article Name: | Anti-RABEP1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA019669 |
| Supplier Catalog Number: | HPA019669 |
| Alternative Catalog Number: | ATA-HPA019669-100,ATA-HPA019669-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | neurocrescin, RAB5EP, rabaptin-5, RABPT5 |
| rabaptin, RAB GTPase binding effector protein 1 |
| Anti-RABEP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.6 mg/ml |
| Isotype: | IgG |
| NCBI: | 9135 |
| UniProt: | Q15276 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RABEP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human parathyroid gland and pancreas tissues using Anti-RABEP1 antibody. Corresponding RABEP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human parathyroid gland shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis using Anti-RABEP1 antibody HPA019669 (A) shows similar pattern to independent antibody HPA024235 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA019669 |
|
|
|
|
|
HPA019669 |
|
|
HPA019669 |
Product Guarantee and Expert Support
