Anti-RABEP1

Catalog Number: ATA-HPA019669
Article Name: Anti-RABEP1
Biozol Catalog Number: ATA-HPA019669
Supplier Catalog Number: HPA019669
Alternative Catalog Number: ATA-HPA019669-100,ATA-HPA019669-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: neurocrescin, RAB5EP, rabaptin-5, RABPT5
rabaptin, RAB GTPase binding effector protein 1
Anti-RABEP1
Clonality: Polyclonal
Concentration: 0.6 mg/ml
Isotype: IgG
NCBI: 9135
UniProt: Q15276
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RABEP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human parathyroid gland and pancreas tissues using Anti-RABEP1 antibody. Corresponding RABEP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis using Anti-RABEP1 antibody HPA019669 (A) shows similar pattern to independent antibody HPA024235 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA019669-100ul
HPA019669-100ul
HPA019669-100ul