Anti-SMURF1

Catalog Number: ATA-HPA019671
Article Name: Anti-SMURF1
Biozol Catalog Number: ATA-HPA019671
Supplier Catalog Number: HPA019671
Alternative Catalog Number: ATA-HPA019671-100,ATA-HPA019671-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1625
Clonality: Polyclonal
Isotype: IgG
NCBI: 57154
UniProt: Q9HCE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
Target: SMURF1
Antibody Type: Monoclonal Antibody
HPA019671-100ul