Anti-RBL2 ChIP certified

Catalog Number: ATA-HPA019703
Article Name: Anti-RBL2 ChIP certified
Biozol Catalog Number: ATA-HPA019703
Supplier Catalog Number: HPA019703
Alternative Catalog Number: ATA-HPA019703-100,ATA-HPA019703-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: p130, Rb2
retinoblastoma-like 2
Anti-RBL2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5934
UniProt: Q08999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RBL2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemical staining of human kidney shows nuclear positivity both in tubules and in glomeruli.
Western blot analysis in human cell line MOLT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019703-100ul
HPA019703-100ul
HPA019703-100ul