Anti-RAB31

Catalog Number: ATA-HPA019717
Article Name: Anti-RAB31
Biozol Catalog Number: ATA-HPA019717
Supplier Catalog Number: HPA019717
Alternative Catalog Number: ATA-HPA019717-100,ATA-HPA019717-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Rab22B
RAB31, member RAS oncogene family
Anti-RAB31
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 11031
UniProt: Q13636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RAB31
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines HeLa and A-431 using Anti-RAB31 antibody. Corresponding RAB31 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in human cell line U-87 MG.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019717-100ul
HPA019717-100ul
HPA019717-100ul