Anti-NUDT5 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA019827
Article Name: Anti-NUDT5 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA019827
Supplier Catalog Number: HPA019827
Alternative Catalog Number: ATA-HPA019827-100,ATA-HPA019827-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: hYSAH1, YSA1H
nudix (nucleoside diphosphate linked moiety X)-type motif 5
Anti-NUDT5
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 11164
UniProt: Q9UKK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NUDT5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA019827
HPA019827
HPA019827