Anti-WIPI2

Catalog Number: ATA-HPA019852
Article Name: Anti-WIPI2
Biozol Catalog Number: ATA-HPA019852
Supplier Catalog Number: HPA019852
Alternative Catalog Number: ATA-HPA019852-100,ATA-HPA019852-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
WD repeat domain, phosphoinositide interacting 2
Anti-WIPI2
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 26100
UniProt: Q9Y4P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: WIPI2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Western blot analysis in human cell line NTERA-2.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA019852-100ul
HPA019852-100ul
HPA019852-100ul