Anti-SH3GLB1

Catalog Number: ATA-HPA019900
Article Name: Anti-SH3GLB1
Biozol Catalog Number: ATA-HPA019900
Supplier Catalog Number: HPA019900
Alternative Catalog Number: ATA-HPA019900-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Bif-1, CGI-61, KIAA0491, PPP1R70
SH3-domain GRB2-like endophilin B1
Anti-SH3GLB1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 51100
UniProt: Q9Y371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: THAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SH3GLB1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SH3GLB1 antibody. Corresponding SH3GLB1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA019900-100ul
HPA019900-100ul
HPA019900-100ul