Anti-CCAR2
Catalog Number:
ATA-HPA019907
- Images (14)
| Article Name: | Anti-CCAR2 |
| Biozol Catalog Number: | ATA-HPA019907 |
| Supplier Catalog Number: | HPA019907 |
| Alternative Catalog Number: | ATA-HPA019907-100,ATA-HPA019907-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DBC-1, DBC1, KIAA1967, NET35 |
| cell cycle and apoptosis regulator 2 |
| Anti-CCAR2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 57805 |
| UniProt: | Q8N163 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCAR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using Anti-CCAR2 antibody. Corresponding CCAR2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney, liver, pancreas and testis using Anti-CCAR2 antibody HPA019907 (A) shows similar protein distribution across tissues to independent antibody HPA019943 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human pancreas using Anti-CCAR2 antibody HPA019907. |
|
|
Immunohistochemical staining of human kidney using Anti-CCAR2 antibody HPA019907. |
|
|
Western blot analysis using Anti-CCAR2 antibody HPA019907 (A) shows similar pattern to independent antibody HPA019943 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA019907-100ul |
|
|
|
|
|
|
|
|
HPA019907-100ul |
|
|
HPA019907-100ul |
Product Guarantee and Expert Support
