Anti-C7orf49
Catalog Number:
ATA-HPA020060
- Images (8)
| Article Name: | Anti-C7orf49 |
| Biozol Catalog Number: | ATA-HPA020060 |
| Supplier Catalog Number: | HPA020060 |
| Alternative Catalog Number: | ATA-HPA020060-100,ATA-HPA020060-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ22450, FLJ27285, MGC5242, MRI |
| chromosome 7 open reading frame 49 |
| Anti-C7orf49 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 78996 |
| UniProt: | Q9BWK5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C7orf49 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and C7orf49 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411410). |
|
|
HPA020060-100ul |
|
|
|
|
|
|
|
|
HPA020060-100ul |
|
|
HPA020060-100ul |
Product Guarantee and Expert Support
