Anti-AGFG2

Catalog Number: ATA-HPA020129
Article Name: Anti-AGFG2
Biozol Catalog Number: ATA-HPA020129
Supplier Catalog Number: HPA020129
Alternative Catalog Number: ATA-HPA020129-100,ATA-HPA020129-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HRBL, RABR
Clonality: Polyclonal
Concentration: 0,05
NCBI: 3268
UniProt: O95081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN
Target: AGFG2
HPA020129-100ul