Anti-RRP1B

Catalog Number: ATA-HPA020324
Article Name: Anti-RRP1B
Biozol Catalog Number: ATA-HPA020324
Supplier Catalog Number: HPA020324
Alternative Catalog Number: ATA-HPA020324-100,ATA-HPA020324-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0179, Nnp1, PPP1R136, RRP1
ribosomal RNA processing 1B
Anti-RRP1B
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23076
UniProt: Q14684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RRP1B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA020324-100ul
HPA020324-100ul
HPA020324-100ul