Anti-METTL16
Catalog Number:
ATA-HPA020352
- Images (7)
| Article Name: | Anti-METTL16 |
| Biozol Catalog Number: | ATA-HPA020352 |
| Supplier Catalog Number: | HPA020352 |
| Alternative Catalog Number: | ATA-HPA020352-100,ATA-HPA020352-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | METT10D, MGC3329 |
| methyltransferase like 16 |
| Anti-METTL16 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 79066 |
| UniProt: | Q86W50 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | METTL16 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear and weak cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human heart shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-METTL16 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
|
|
|
HPA020352-100ul |
|
|
HPA020352-100ul |
Product Guarantee and Expert Support
