Anti-CLIP2
Catalog Number:
ATA-HPA020430
- Images (8)
| Article Name: | Anti-CLIP2 |
| Biozol Catalog Number: | ATA-HPA020430 |
| Supplier Catalog Number: | HPA020430 |
| Alternative Catalog Number: | ATA-HPA020430-100,ATA-HPA020430-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CLIP, CLIP-115, CYLN2, KIAA0291, WBSCR3, WBSCR4, WSCR3, WSCR4 |
| CAP-GLY domain containing linker protein 2 |
| Anti-CLIP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 7461 |
| UniProt: | Q9UDT6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CLIP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using Anti-CLIP2 antibody. Corresponding CLIP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-CLIP2 antibody. Corresponding CLIP2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
HPA020430-100ul |
|
|
|
|
|
HPA020430-100ul |
|
|
HPA020430-100ul |
Product Guarantee and Expert Support
