Anti-NSUN5

Catalog Number: ATA-HPA020536
Article Name: Anti-NSUN5
Biozol Catalog Number: ATA-HPA020536
Supplier Catalog Number: HPA020536
Alternative Catalog Number: ATA-HPA020536-100,ATA-HPA020536-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: (NOL1), FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL
NOP2/Sun domain family, member 5
Anti-NSUN5
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 55695
UniProt: Q96P11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NSUN5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
Immunohistochemical staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines Caco-2 and U-251MG using Anti-NSUN5 antibody. Corresponding NSUN5 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA020536-100ul
HPA020536-100ul
HPA020536-100ul