Anti-NEK1
Catalog Number:
ATA-HPA020873
- Images (9)
| Article Name: | Anti-NEK1 |
| Biozol Catalog Number: | ATA-HPA020873 |
| Supplier Catalog Number: | HPA020873 |
| Alternative Catalog Number: | ATA-HPA020873-100,ATA-HPA020873-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1901, NY-REN-55 |
| NIMA-related kinase 1 |
| Anti-NEK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.7 mg/ml |
| Isotype: | IgG |
| NCBI: | 4750 |
| UniProt: | Q96PY6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NEK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and skin tissues using HPA020873 antibody. Corresponding NEK1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium, fallopian tube, skin and testis using Anti-NEK1 antibody HPA020873 (A) shows similar protein distribution across tissues to independent antibody HPA040413 (B). |
|
|
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells as expected. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human Fallopian tube shows strong cytoplasmic/ membranous positivity in glandular cells. |
|
|
HPA020873-100ul |
|
|
HPA020873-100ul |
|
|
HPA020873-100ul |
Product Guarantee and Expert Support
