Anti-MYBPC1

Product Overview

• Article Name: Anti-MYBPC1
• Biozol Catalog Number: ATA-HPA021004
• Supplier Catalog Number: HPA021004
• Alternative Catalog Number: ATA-HPA021004-100,ATA-HPA021004-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MYBPC1

Product Description

myosin binding protein C, slow type

Additional Information

Anti-MYBPC1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 4604
• UniProt: Q00872
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MYBPC1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-MYBPC1 antibody. Corresponding MYBPC1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney, liver, lymph node and skeletal muscle using Anti-MYBPC1 antibody HPA021004 (A) shows similar protein distribution across tissues to independent antibody HPA027614 (B).

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human skeletal muscle shows high expression.

Immunohistochemical staining of human kidney using Anti-MYBPC1 antibody HPA021004.

Immunohistochemical staining of human lymph node using Anti-MYBPC1 antibody HPA021004.

HPA021004-100ul

HPA021004-100ul

HPA021004-100ul