Anti-EBAG9

Catalog Number: ATA-HPA021154
Article Name: Anti-EBAG9
Biozol Catalog Number: ATA-HPA021154
Supplier Catalog Number: HPA021154
Alternative Catalog Number: ATA-HPA021154-100,ATA-HPA021154-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EB9, RCAS1
estrogen receptor binding site associated, antigen, 9
Anti-EBAG9
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 9166
UniProt: O00559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: EBAG9
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-EBAG9 antibody HPA021154 (A) shows similar protein distribution across tissues to independent antibody HPA021153 (B).
Immunohistochemical staining of human liver using Anti-EBAG9 antibody HPA021154.
Immunohistochemical staining of human lymph node using Anti-EBAG9 antibody HPA021154.
Immunohistochemical staining of human cerebral cortex using Anti-EBAG9 antibody HPA021154.
Immunohistochemical staining of human colon using Anti-EBAG9 antibody HPA021154.
HPA021154-100ul
HPA021154-100ul
HPA021154-100ul