Anti-SNF8
Catalog Number:
ATA-HPA021228
| Article Name: |
Anti-SNF8 |
| Biozol Catalog Number: |
ATA-HPA021228 |
| Supplier Catalog Number: |
HPA021228 |
| Alternative Catalog Number: |
ATA-HPA021228-100,ATA-HPA021228-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
Dot3, EAP30, VPS22 |
| Rabbit Polyclonal SNF8 Antibody against Human SNF8 subunit of ESCRT-II. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
11267 |
| UniProt: |
Q96H20 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL |