Anti-LRWD1

Catalog Number: ATA-HPA021320
Article Name: Anti-LRWD1
Biozol Catalog Number: ATA-HPA021320
Supplier Catalog Number: HPA021320
Alternative Catalog Number: ATA-HPA021320-100,ATA-HPA021320-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CENP-33, DKFZp434K1815, ORCA
leucine-rich repeats and WD repeat domain containing 1
Anti-LRWD1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 222229
UniProt: Q9UFC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LRWD1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & vesicles.
Immunohistochemistry analysis in human testis and prostate tissues using Anti-LRWD1 antibody. Corresponding LRWD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA021320-100ul
HPA021320-100ul
HPA021320-100ul