Anti-INSL6

Catalog Number: ATA-HPA021364
Article Name: Anti-INSL6
Biozol Catalog Number: ATA-HPA021364
Supplier Catalog Number: HPA021364
Alternative Catalog Number: ATA-HPA021364-100,ATA-HPA021364-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RIF1
insulin-like 6
Anti-INSL6
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 11172
UniProt: Q9Y581
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: INSL6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and prostate tissues using Anti-INSL6 antibody. Corresponding INSL6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA021364-100ul
HPA021364-100ul
HPA021364-100ul