Anti-ADAMTS3

Catalog Number: ATA-HPA021369
Article Name: Anti-ADAMTS3
Biozol Catalog Number: ATA-HPA021369
Supplier Catalog Number: HPA021369
Alternative Catalog Number: ATA-HPA021369-100,ATA-HPA021369-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADAMTS-4, KIAA0366
ADAM metallopeptidase with thrombospondin type 1 motif, 3
Clonality: Polyclonal
Isotype: IgG
NCBI: 9508
UniProt: O15072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL
Target: ADAMTS3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
HPA021369-100ul