Anti-SLC38A10

Catalog Number: ATA-HPA021374
Article Name: Anti-SLC38A10
Biozol Catalog Number: ATA-HPA021374
Supplier Catalog Number: HPA021374
Alternative Catalog Number: ATA-HPA021374-100,ATA-HPA021374-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC15523, PP1744
solute carrier family 38, member 10
Anti-SLC38A10
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 124565
UniProt: Q9HBR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PVPHDKVVVDEGQDREVPEENKPPSRHAGGKAPGVQGQMAPPLPDSEREKQEPEQGEVGKRPGQAQALEEAGDLPEDPQKVPEADGQPA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC38A10
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-SLC38A10 antibody. Corresponding SLC38A10 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human gallbladder shows high expression.
HPA021374-100ul
HPA021374-100ul
HPA021374-100ul