Anti-ZNF750
Catalog Number:
ATA-HPA021573
- Images (8)
| Article Name: | Anti-ZNF750 |
| Biozol Catalog Number: | ATA-HPA021573 |
| Supplier Catalog Number: | HPA021573 |
| Alternative Catalog Number: | ATA-HPA021573-100,ATA-HPA021573-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ13841, Zfp750 |
| zinc finger protein 750 |
| Anti-ZNF750 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 79755 |
| UniProt: | Q32MQ0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ACAVDSSEEQKQTAAVALCQLAAYSPRNIRVGDGDAAAPEPACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQGAKKAKLQDTARVFTLRRRAR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZNF750 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human skin and liver tissues using HPA021573 antibody. Corresponding ZNF750 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows moderate nuclear and cytoplasmic/membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA021573-100ul |
|
|
HPA021573-100ul |
|
|
HPA021573-100ul |
Product Guarantee and Expert Support
