Anti-DNAI1

Catalog Number: ATA-HPA021649
Article Name: Anti-DNAI1
Biozol Catalog Number: ATA-HPA021649
Supplier Catalog Number: HPA021649
Alternative Catalog Number: ATA-HPA021649-100,ATA-HPA021649-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CILD1, DIC1, PCD
dynein, axonemal, intermediate chain 1
Anti-DNAI1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 27019
UniProt: Q9UI46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: APHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNAI1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human fallopian tube and colon tissues using Anti-DNAI1 antibody. Corresponding DNAI1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-DNAI1 antibody HPA021649 (A) shows similar protein distribution across tissues to independent antibody HPA021843 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
Immunohistochemical staining of human kidney using Anti-DNAI1 antibody HPA021649.
Immunohistochemical staining of human testis using Anti-DNAI1 antibody HPA021649.
Immunohistochemical staining of human lymph node using Anti-DNAI1 antibody HPA021649.
Western blot analysis in control (vector only transfected HEK293T lysate) and dNAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402158).
HPA021649-100ul
HPA021649-100ul
HPA021649-100ul