Anti-CFAP157

Catalog Number: ATA-HPA021786
Article Name: Anti-CFAP157
Biozol Catalog Number: ATA-HPA021786
Supplier Catalog Number: HPA021786
Alternative Catalog Number: ATA-HPA021786-100,ATA-HPA021786-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C9orf117
cilia and flagella associated protein 157
Anti-CFAP157
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 286207
UniProt: Q5JU67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DNQALKSQRDQLSLQLEQQQVDLQRLQQELANEQKVRASLEAALVQATSFLQNILQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSST
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CFAP157
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP157 antibody. Corresponding CFAP157 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA021786-100ul
HPA021786-100ul
HPA021786-100ul