Anti-NUP88

Catalog Number: ATA-HPA021816
Article Name: Anti-NUP88
Biozol Catalog Number: ATA-HPA021816
Supplier Catalog Number: HPA021816
Alternative Catalog Number: ATA-HPA021816-100,ATA-HPA021816-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC8530
nucleoporin 88kDa
Anti-NUP88
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 4927
UniProt: Q99567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QLLTRNVVFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYPSEILDPHVV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NUP88
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
HPA021816-100ul
HPA021816-100ul