Anti-PARG

Catalog Number: ATA-HPA021819
Article Name: Anti-PARG
Biozol Catalog Number: ATA-HPA021819
Supplier Catalog Number: HPA021819
Alternative Catalog Number: ATA-HPA021819-100,ATA-HPA021819-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PARG
poly (ADP-ribose) glycohydrolase
Anti-PARG
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 8505
UniProt: Q86W56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PARG
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-PARG antibody. Corresponding PARG RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA021819-100ul
HPA021819-100ul
HPA021819-100ul