Anti-MAGEA4
Catalog Number:
ATA-HPA021942
- Images (8)
| Article Name: | Anti-MAGEA4 |
| Biozol Catalog Number: | ATA-HPA021942 |
| Supplier Catalog Number: | HPA021942 |
| Alternative Catalog Number: | ATA-HPA021942-100,ATA-HPA021942-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT1.4, MAGE-41, MAGE-X2, MAGE4, MAGE4A, MAGE4B, MGC21336 |
| melanoma antigen family A, 4 |
| Anti-MAGEA4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4103 |
| UniProt: | P43358 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MAGEA4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MAGEA4 antibody. Corresponding MAGEA4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
HPA021942-100ul |
|
|
|
|
|
HPA021942-100ul |
|
|
HPA021942-100ul |
Product Guarantee and Expert Support
