Anti-MPRIP
Catalog Number:
ATA-HPA022034
- Images (8)
| Article Name: | Anti-MPRIP |
| Biozol Catalog Number: | ATA-HPA022034 |
| Supplier Catalog Number: | HPA022034 |
| Alternative Catalog Number: | ATA-HPA022034-100,ATA-HPA022034-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | M-RIP, p116Rip, RHOIP3 |
| myosin phosphatase Rho interacting protein |
| Anti-MPRIP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 23164 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RVEGHVGELGDFQVKNSQALMCLENCREQLRSLPRASQEDEQDARAASLASVESALVSAIQALQHWPAPAHGGARAQLETGGTEENGKPASLQQCSQSELTEQEQVRLLSDQIALEASLISQIADSLKNTT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MPRIP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, smooth muscle and testis using Anti-MPRIP antibody HPA022034 (A) shows similar protein distribution across tissues to independent antibody HPA022901 (B). |
|
|
Immunohistochemical staining of human liver using Anti-MPRIP antibody HPA022034. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MPRIP antibody HPA022034. |
|
|
Immunohistochemical staining of human testis using Anti-MPRIP antibody HPA022034. |
|
|
Immunohistochemical staining of human smooth muscle using Anti-MPRIP antibody HPA022034. |
|
|
HPA022034-100ul |
|
|
HPA022034-100ul |
|
|
HPA022034-100ul |
Product Guarantee and Expert Support
