Anti-TP53BP1 ChIP certified

Catalog Number: ATA-HPA022133
Article Name: Anti-TP53BP1 ChIP certified
Biozol Catalog Number: ATA-HPA022133
Supplier Catalog Number: HPA022133
Alternative Catalog Number: ATA-HPA022133-100,ATA-HPA022133-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 53BP1, p202
tumor protein p53 binding protein 1
Anti-TP53BP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7158
UniProt: Q12888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TP53BP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
Immunohistochemical staining of human cerebellum shows strong nuclear positivity.
Western blot analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TP53BP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA022133-100ul
HPA022133-100ul
HPA022133-100ul