Anti-ATP6V0A1
Catalog Number:
ATA-HPA022144
- Images (8)
| Article Name: | Anti-ATP6V0A1 |
| Biozol Catalog Number: | ATA-HPA022144 |
| Supplier Catalog Number: | HPA022144 |
| Alternative Catalog Number: | ATA-HPA022144-100,ATA-HPA022144-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | a1, ATP6N1, ATP6N1A, Stv1, Vph1, VPP1 |
| ATPase, H+ transporting, lysosomal V0 subunit a1 |
| Anti-ATP6V0A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 535 |
| UniProt: | Q93050 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATP6V0A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. |
|
|
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ATP6V0A1 antibody. Corresponding ATP6V0A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
HPA022144-100ul |
|
|
|
|
|
HPA022144-100ul |
|
|
HPA022144-100ul |
Product Guarantee and Expert Support
