Anti-RABEPK, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RABEPK, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA022471
• Supplier Catalog Number: HPA022471
• Alternative Catalog Number: ATA-HPA022471-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: bA65N13.1, RAB9P40

Product Description

Rabbit Polyclonal RABEPK Antibody against Human Rab9 effector protein with kelch motifs. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 10244
• UniProt: Q7Z6M1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: CIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD