Anti-RABEPK

Catalog Number: ATA-HPA022471
Article Name: Anti-RABEPK
Biozol Catalog Number: ATA-HPA022471
Supplier Catalog Number: HPA022471
Alternative Catalog Number: ATA-HPA022471-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: bA65N13.1, RAB9P40
Rabbit Polyclonal RABEPK Antibody against Human Rab9 effector protein with kelch motifs. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 10244
UniProt: Q7Z6M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: CIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD
WB Image Caption 1