Anti-CANT1

Catalog Number: ATA-HPA022818
Article Name: Anti-CANT1
Biozol Catalog Number: ATA-HPA022818
Supplier Catalog Number: HPA022818
Alternative Catalog Number: ATA-HPA022818-100,ATA-HPA022818-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SCAN-1, SHAPY
calcium activated nucleotidase 1
Anti-CANT1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 124583
UniProt: Q8WVQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TTTTGDVVNENPEWVKVVGYKGSVDHENWVSNYNALRAAAGIQPPGYLIHESACWSDTLQRWFFLPRRASQERYSEKDD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CANT1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-CANT1 antibody. Corresponding CANT1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, pancreas, prostate and rectum using Anti-CANT1 antibody HPA022818 (A) shows similar protein distribution across tissues to independent antibody HPA019627 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human rectum shows high expression.
Immunohistochemical staining of human cerebral cortex using Anti-CANT1 antibody HPA022818.
Immunohistochemical staining of human prostate using Anti-CANT1 antibody HPA022818.
HPA022818-100ul
HPA022818-100ul
HPA022818-100ul