Anti-CANT1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CANT1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA022818
• Supplier Catalog Number: HPA022818
• Alternative Catalog Number: ATA-HPA022818-100,ATA-HPA022818-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SCAN-1, SHAPY

Product Description

calcium activated nucleotidase 1

Additional Information

Anti-CANT1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 124583
• UniProt: Q8WVQ1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: TTTTGDVVNENPEWVKVVGYKGSVDHENWVSNYNALRAAAGIQPPGYLIHESACWSDTLQRWFFLPRRASQERYSEKDD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CANT1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-CANT1 antibody. Corresponding CANT1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, pancreas, prostate and rectum using Anti-CANT1 antibody HPA022818 (A) shows similar protein distribution across tissues to independent antibody HPA019627 (B).

Immunohistochemical staining of human pancreas shows low expression as expected.

Immunohistochemical staining of human rectum shows high expression.

Immunohistochemical staining of human cerebral cortex using Anti-CANT1 antibody HPA022818.

Immunohistochemical staining of human prostate using Anti-CANT1 antibody HPA022818.

HPA022818

HPA022818

HPA022818