Anti-CANT1
Catalog Number:
ATA-HPA022818
- Images (9)
| Article Name: | Anti-CANT1 |
| Biozol Catalog Number: | ATA-HPA022818 |
| Supplier Catalog Number: | HPA022818 |
| Alternative Catalog Number: | ATA-HPA022818-100,ATA-HPA022818-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SCAN-1, SHAPY |
| calcium activated nucleotidase 1 |
| Anti-CANT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 124583 |
| UniProt: | Q8WVQ1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TTTTGDVVNENPEWVKVVGYKGSVDHENWVSNYNALRAAAGIQPPGYLIHESACWSDTLQRWFFLPRRASQERYSEKDD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CANT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-CANT1 antibody. Corresponding CANT1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, pancreas, prostate and rectum using Anti-CANT1 antibody HPA022818 (A) shows similar protein distribution across tissues to independent antibody HPA019627 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CANT1 antibody HPA022818. |
|
|
Immunohistochemical staining of human prostate using Anti-CANT1 antibody HPA022818. |
|
|
HPA022818-100ul |
|
|
HPA022818-100ul |
|
|
HPA022818-100ul |
Product Guarantee and Expert Support
