Anti-NOTUM

Catalog Number: ATA-HPA022851
Article Name: Anti-NOTUM
Biozol Catalog Number: ATA-HPA022851
Supplier Catalog Number: HPA022851
Alternative Catalog Number: ATA-HPA022851-100,ATA-HPA022851-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 147111
UniProt: Q6P988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFL
Target: NOTUM
Antibody Type: Monoclonal Antibody
HPA022851-100ul