Anti-CACNA1B

Catalog Number: ATA-HPA022919
Article Name: Anti-CACNA1B
Biozol Catalog Number: ATA-HPA022919
Supplier Catalog Number: HPA022919
Alternative Catalog Number: ATA-HPA022919-100,ATA-HPA022919-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CACNL1A5, CACNN, Cav2.2
Clonality: Polyclonal
Isotype: IgG
NCBI: 774
UniProt: Q00975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Target: CACNA1B
Antibody Type: Monoclonal Antibody
HPA022919-100ul