Anti-RUFY3
Catalog Number:
ATA-HPA022952
- Images (8)
| Article Name: | Anti-RUFY3 |
| Biozol Catalog Number: | ATA-HPA022952 |
| Supplier Catalog Number: | HPA022952 |
| Alternative Catalog Number: | ATA-HPA022952-100,ATA-HPA022952-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0871, RIPx, Singar1 |
| RUN and FYVE domain containing 3 |
| Anti-RUFY3 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 22902 |
| UniProt: | Q7L099 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RUFY3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-RUFY3 antibody. Corresponding RUFY3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis using Anti-RUFY3 antibody HPA022952 (A) shows similar pattern to independent antibody HPA022970 (B). |
|
|
HPA022952-100ul |
|
|
|
|
|
HPA022952-100ul |
|
|
HPA022952-100ul |
Product Guarantee and Expert Support
