Anti-SGPL1
Catalog Number:
ATA-HPA023086
- Images (8)
| Article Name: | Anti-SGPL1 |
| Biozol Catalog Number: | ATA-HPA023086 |
| Supplier Catalog Number: | HPA023086 |
| Alternative Catalog Number: | ATA-HPA023086-100,ATA-HPA023086-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SPL |
| sphingosine-1-phosphate lyase 1 |
| Anti-SGPL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 8879 |
| UniProt: | O95470 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SGPL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-SGPL1 antibody HPA023086 (A) shows similar protein distribution across tissues to independent antibody HPA021125 (B). |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes. |
|
|
HPA023086-100ul |
|
|
HPA023086-100ul |
|
|
HPA023086-100ul |
Product Guarantee and Expert Support
