Anti-EIF3H Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-EIF3H Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA023117
• Supplier Catalog Number: HPA023117
• Alternative Catalog Number: ATA-HPA023117-100,ATA-HPA023117-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: eIF3-gamma, eIF3-p40, eIF3h, EIF3S3

Product Description

eukaryotic translation initiation factor 3, subunit H

Additional Information

Anti-EIF3H

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 8667
• UniProt: O15372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: EIF3H
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

HPA023117

HPA023117

HPA023117