Anti-PINX1
Catalog Number:
ATA-HPA023139
- Images (7)
| Article Name: | Anti-PINX1 |
| Biozol Catalog Number: | ATA-HPA023139 |
| Supplier Catalog Number: | HPA023139 |
| Alternative Catalog Number: | ATA-HPA023139-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ20565, LPTL, LPTS, MGC8850, PinX1 |
| PIN2/TERF1 interacting, telomerase inhibitor 1 |
| Anti-PINX1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 54984 |
| UniProt: | Q96BK5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PINX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and PINX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413467). |
|
|
HPA023139-100ul |
|
|
|
|
|
HPA023139-100ul |
|
|
HPA023139-100ul |
Product Guarantee and Expert Support
