Anti-PINX1

Catalog Number: ATA-HPA023146
Article Name: Anti-PINX1
Biozol Catalog Number: ATA-HPA023146
Supplier Catalog Number: HPA023146
Alternative Catalog Number: ATA-HPA023146-100,ATA-HPA023146-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20565, Gno1, LPTL, LPTS, MGC8850, PinX1, Pxr1
Clonality: Polyclonal
Isotype: IgG
NCBI: 54984
UniProt: Q96BK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQP
Target: PINX1
Antibody Type: Monoclonal Antibody
HPA023146-100ul