Anti-VSIG8
Catalog Number:
ATA-HPA023219
- Images (8)
| Article Name: | Anti-VSIG8 |
| Biozol Catalog Number: | ATA-HPA023219 |
| Supplier Catalog Number: | HPA023219 |
| Alternative Catalog Number: | ATA-HPA023219-100,ATA-HPA023219-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | VSIG8 |
| V-set and immunoglobulin domain containing 8 |
| Anti-VSIG8 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 391123 |
| UniProt: | Q5VU13 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VSIG8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human hair follicle shows moderate cytoplasmic positivity. |
|
|
Immunohistochemical staining of human skin shows moderate granular cytoplasmic positivity in epidermal cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells. |
|
|
Immunohistochemical staining of human small intestine shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows no positivity in glandular cells. |
|
|
HPA023219-100ul |
|
|
HPA023219-100ul |
|
|
HPA023219-100ul |
Product Guarantee and Expert Support
