Anti-THEM6

Catalog Number: ATA-HPA023255
Article Name: Anti-THEM6
Biozol Catalog Number: ATA-HPA023255
Supplier Catalog Number: HPA023255
Alternative Catalog Number: ATA-HPA023255-100,ATA-HPA023255-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C8orf55, DSCD75
thioesterase superfamily member 6
Anti-THEM6
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 51337
UniProt: Q8WUY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPADLQHWISYNEASSQLLRMESGLSDVTKDQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: THEM6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
HPA023255-100ul
HPA023255-100ul
HPA023255-100ul